LL-37 Nasal Spray

Direct Anti Peptide offers LL-37 Nasal Spray (CAP-18), a high-purity antimicrobial research peptide verified at ≥98% purity by HPLC and mass spectrometry. This product is supplied exclusively for in vitro laboratory research applications. For research use only. Not for human or veterinary use. Not for clinical, diagnostic, or consumptive applications.

Product Overview

LL-37, also designated CAP-18 (Cathelicidin Antimicrobial Peptide 18), is a naturally occurring cationic host-defense peptide and the sole human member of the cathelicidin family. It is expressed predominantly by epithelial cells, neutrophils, and macrophages, positioning it as a central component of innate immune defense mechanisms. Researchers investigating mucosal immunity, antimicrobial peptide biology, and airway inflammation have identified LL-37 as a compelling subject of study. Direct Anti Peptide makes this research-grade peptide available to qualified laboratory professionals seeking to buy LL-37 Nasal Spray online with confidence in purity and analytical traceability.

Peptide Structure & Amino Acid Sequence

LL-37 is a 37-amino acid amphipathic alpha-helical peptide derived from the C-terminal domain of the human cathelicidin precursor protein hCAP-18. Its sequence is: [LL-37, 37 aa] The double leucine (LL) at the N-terminus gives the peptide its common designation. The helical conformation adopted in membrane-mimetic environments is considered central to its studied interactions with microbial membranes and immune cell receptors. This structural feature has made LL-37 a widely referenced model peptide in antimicrobial and immunomodulatory research.

Chemical & Physical Characteristics

• Peptide Name: LL-37 (CAP-18)
• Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃S
• Molecular Weight: Approximately 4,493.3 Da
• Appearance: White to off-white lyophilized powder
• Solubility: Soluble in sterile water or aqueous buffers at research-appropriate concentrations
• CAS Number: 154947-66-7
• Purity: ≥98% by HPLC

These physicochemical properties make LL-37 a well-characterized and reproducible research tool across diverse in vitro study models.

Purity & Analytical Verification (HPLC & MS)

Every batch of LL-37 Nasal Spray peptide supplied by Direct Anti Peptide undergoes rigorous analytical verification prior to release. Reverse-phase high-performance liquid chromatography (RP-HPLC) is used to confirm peptide purity at ≥98%, while mass spectrometry (MS) validates the correct molecular weight and sequence integrity. Certificates of Analysis (CoA) are available upon request, providing full batch-level transparency. Researchers ordering from Direct Anti Peptide can trust that each unit meets the exacting purity standards required for reproducible, publication-quality laboratory investigations.

Quality Control & Lyophilization Integrity

LL-37 is supplied in lyophilized form, a process that removes residual moisture under vacuum conditions to preserve peptide stability and extend shelf life. Lyophilization minimizes degradation risk during transit and storage, ensuring that peptide integrity is maintained from production through to laboratory use. Each vial is sealed under inert conditions to prevent oxidation and contamination. Batch-to-batch consistency is maintained through standardized synthesis and quality control protocols, giving research teams confidence in the reliability of their experimental inputs.

Safety, Handling & Laboratory Precautions

LL-37 Nasal Spray is a research reagent intended exclusively for use by trained laboratory professionals operating within appropriately equipped research facilities. Standard laboratory personal protective equipment (PPE) — including gloves, safety eyewear, and lab coat — should be worn at all times when handling this peptide. Researchers should consult applicable institutional biosafety guidelines and Safety Data Sheets (SDS) before use. This product must not be used on or administered to humans or animals under any circumstances.

Reconstitution, Packaging & Storage

Upon receipt, LL-37 should be stored at −20°C in a dry, frost-free environment away from direct light and moisture. For research reconstitution purposes, sterile aqueous solvents appropriate to the specific experimental protocol should be selected by qualified laboratory personnel. Once reconstituted, aliquot and store as appropriate to minimize freeze-thaw cycles. Packaging is designed to maintain lyophilized integrity during international shipping and laboratory handling. Specific storage and handling conditions should be determined by the receiving research institution in accordance with their standard operating procedures.

Intended Research Use & Market Positioning

LL-37 has attracted significant scientific interest across multiple research domains, including innate immunity, mucosal biology, respiratory research, antimicrobial peptide pharmacology, and wound-healing models. Published in vitro studies have explored its interactions with epithelial cells, immune signaling pathways, and microbial membranes. Researchers investigating airway mucosal defense, biofilm disruption, or cathelicidin biology will find LL-37 Nasal Spray peptide a highly relevant and well-documented research compound. Direct Anti Peptide positions this product for qualified academic, pharmaceutical, and biotechnology research teams seeking a competitively priced, analytically verified peptide at best price.

Ordering, Availability & Fulfillment

Direct Anti Peptide offers LL-37 Nasal Spray for sale through a streamlined eCommerce platform optimized for research procurement. Order now to benefit from fast dispatch, secure packaging, and reliable international fulfillment. Our team supports research institutions, universities, and private laboratories with efficient order processing and responsive customer service. Bulk and repeat-order pricing inquiries are welcome. Buy online today and experience the Direct Anti Peptide commitment to quality, compliance, and competitive pricing.

Legal & Regulatory Disclaimer

For research use only. Not for human or veterinary use. Not for clinical, diagnostic, or consumptive applications. LL-37 Nasal Spray is sold exclusively as a laboratory research reagent. It has not been evaluated by any regulatory authority for safety or efficacy in humans or animals. Direct Anti Peptide assumes no liability for misuse, improper handling, or use outside of qualified research settings. All purchasers are solely responsible for ensuring compliance with applicable local, national, and international laws and regulations governing the procurement and use of research peptides. This product is not a drug, supplement, or therapeutic agent.