LL-37 (Cap-18) Pre-Mixed Pen 5mg

The LL-37 (CAP-18) Pre-Mixed Pen is a precision-engineered, ready-to-use research delivery system containing ≥98% purity LL-37 peptide, pre-mixed with bacteriostatic water for streamlined laboratory workflows. Available at Direct Anti Peptide as a complete kit or individual cartridges, this system is designed exclusively for qualified research professionals. For research use only. Not for human or veterinary use. Not for clinical, diagnostic, or consumptive applications.

Product Overview

Direct Anti Peptide’s LL-37 (CAP-18) Pre-Mixed Pen offers researchers a convenient, consistent, and reproducible format for working with one of the most studied antimicrobial peptides in the cathelicidin family. The complete kit includes one pre-mixed cartridge, one peptide cartridge pen, one durable carry case, and three pen needle tips — everything required to support structured, repeatable laboratory investigation. Individual cartridges are also available separately, and multi-cartridge packs offer additional value for extended research programs.

Peptide Structure & Amino Acid Sequence

LL-37, also designated CAP-18 (Cathelicidin Antimicrobial Peptide 18), is a 37-amino acid cationic host defence peptide derived from the C-terminal domain of the human cathelicidin protein hCAP-18. Its sequence — [LL-37, 37 aa] — forms an amphipathic alpha-helical structure under physiological salt conditions. This helical conformation is central to its well-documented interactions with bacterial membranes and has made it a subject of extensive in vitro and in vivo research interest. The peptide carries a net positive charge, enabling electrostatic interactions with negatively charged microbial surfaces, a property that has driven significant academic and preclinical investigation.

Chemical & Physical Characteristics

• Peptide Name: LL-37 (CAP-18)
• Family: Cathelicidin Antimicrobial Peptide
• Amino Acid Length: 37 residues
• Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃S
• Molecular Weight: Approximately 4,493 Da
• Physical Form: Lyophilised white powder (pre-mixed in cartridge with bacteriostatic water)
• Solubility: Soluble in aqueous buffers and bacteriostatic water
• Purity: ≥98% by HPLC

Purity & Analytical Verification (HPLC & MS)

Every batch of LL-37 (CAP-18) supplied by Direct Anti Peptide undergoes rigorous analytical testing prior to release. High-performance liquid chromatography (HPLC) confirms a minimum purity of ≥98%, ensuring that research outcomes are not compromised by peptide-related impurities or truncated sequences. Mass spectrometry (MS) analysis validates the molecular weight and confirms correct peptide identity. These dual verification methods meet the quality expectations of academic institutions, contract research organisations, and independent laboratory professionals.

Quality Control & Lyophilisation Integrity

LL-37 (CAP-18) is initially produced as a lyophilised powder under controlled freeze-drying conditions that preserve structural integrity, biological activity, and long-term stability. Each cartridge in the pre-mixed pen system is prepared under strict quality control protocols, with the peptide pre-combined with 2 ml of bacteriostatic water to create a ready-to-use research formulation. Cartridge sealing and fill consistency are verified at the point of manufacture to ensure reproducibility across research applications.

Safety, Handling & Laboratory Precautions

This product is intended exclusively for use by trained research professionals operating within appropriately equipped laboratory environments. Standard laboratory personal protective equipment (PPE) — including gloves, eye protection, and a lab coat — should be worn at all times when handling this peptide. LL-37 (CAP-18) should not be ingested, inhaled, or brought into contact with skin or mucous membranes. All handling, storage, and disposal must comply with applicable institutional biosafety guidelines and local regulatory frameworks. This product is not approved for use in humans or animals under any circumstances.

Reconstitution, Packaging & Storage

The pre-mixed pen cartridge arrives ready for use, with LL-37 (CAP-18) already combined with 2 ml of bacteriostatic water. No additional reconstitution steps are required for the cartridge format. The complete kit includes one pre-mixed cartridge, one reusable peptide pen, one protective carry case, and three sterile needle tips. Individual and multi-pack cartridge options are available for researchers requiring extended or parallel experimental runs. Store the product at 2–8°C upon receipt and protect from direct light and moisture. Once mixed, use within the period recommended for bacteriostatic water-based formulations under refrigerated conditions.

Intended Research Use & Market Positioning

LL-37 (CAP-18) is among the most extensively investigated human antimicrobial peptides in current academic and preclinical literature. Research interest spans its roles in innate immune modulation, host defence against gram-positive and gram-negative bacteria, antifungal activity, antiviral properties, wound healing models, and inflammatory pathway regulation. The pre-mixed pen format is specifically designed to reduce preparation variability, making it an ideal tool for researchers seeking consistent dosing formats across multiple experimental time points. Direct Anti Peptide positions this product as a premium-grade, compliance-ready research reagent for serious laboratory professionals.

Ordering, Availability & Fulfillment

Buy LL-37 (CAP-18) Pre-Mixed Pen online from Direct Anti Peptide with confidence. Our products are available for sale with fast dispatch, secure packaging, and full traceability from batch to delivery. Whether you are ordering a single cartridge for exploratory research or a multi-pack for an extended study, our fulfilment process is designed to minimise lead times and protect product integrity during transit. Order now to take advantage of our competitive pricing and reliable supply chain for research-grade peptides.

Legal & Regulatory Disclaimer

For research use only. Not for human or veterinary use. Not for clinical, diagnostic, or consumptive applications. LL-37 (CAP-18) Pre-Mixed Pen is sold exclusively as a laboratory research reagent. Direct Anti Peptide makes no claims regarding therapeutic efficacy, safety for administration, or suitability for any use beyond in vitro or controlled preclinical research contexts. Purchasers are solely responsible for ensuring compliance with all applicable local, national, and international regulations governing the purchase, possession, and use of research peptides. This product must not be used in any manner inconsistent with its research-only designation.